PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G12630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 556aa    MW: 61595.1 Da    PI: 7.0278
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G12630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.6e-11113150745
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       Ede l++ ++ +G ++W+t+ar ++ gR + qc+ rw 
  OMERI02G12630.1 113 HEDESLIQMINIYGHNNWETVARAIP-GRNAQQCRVRWK 150
                      69************************.***********6 PP

2Myb_DNA-binding33.97.3e-11159201145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W+ eE+++l+++ + +G++ W + a+++  gRt   +k++w+
  OMERI02G12630.1 159 KQAWSREEELRLIHVQQIYGNK-WCRMAEHFT-GRTSAAIKEHWR 201
                      799*******************.********9.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.3E-5106155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-17113161IPR009057Homeodomain-like
PROSITE profilePS500908.943114153IPR017877Myb-like domain
PfamPF139211.5E-11114170No hitNo description
CDDcd001673.66E-10114153No hitNo description
SuperFamilySSF466894.03E-21133209IPR009057Homeodomain-like
PROSITE profilePS5129419.313154208IPR017930Myb domain
SMARTSM007175.5E-10158206IPR001005SANT/Myb domain
CDDcd001671.05E-8161201No hitNo description
Gene3DG3DSA:1.10.10.602.6E-15162209IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MEYLRHTSSP GVNENLPSRL LRTLRLRQDE SRLPVASRAV EGEGEGEGEG NLGNALEDSH  60
KHCQGEELEA GQSCKIHYQV VMDKCSIEIS EKRRRRWSTK ESGLDFNFII LLHEDESLIQ  120
MINIYGHNNW ETVARAIPGR NAQQCRVRWK FNLDPAINKQ AWSREEELRL IHVQQIYGNK  180
WCRMAEHFTG RTSAAIKEHW RGPMKRKLNS YLASGLLKKS PGLPENLSVS QSSDSNILQQ  240
CDVSSDENKL LSDLRPSLKS KGVSSKCDGS SSENQLLSDL RASLKSKGAS SKCDGSSDDN  300
QLLSDLRASL KSKEGASSKC DGSSDENKLL SDLRACLKSK QGASSKCDGS FDENQLLSDL  360
QASLKSKQRT SSKYKLGASS KSKQGTSSKS KQGIIDLCEN TDTSEGESSK LICTERPDPD  420
SGEASQRIRD RLNWRKRARK KLVFLSSPVE LKVSAVAESE RHLQESKEMS PEVNIVSPPA  480
VLQGFSPEVP SVCEKIVEPP LADFNQTKNV CSLETSSDPC TLEQHLANVS DLLDMSYIDG  540
LMIIPPAGCP YDGDFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2011421014110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1209130.0AK120913.1 Oryza sativa Japonica Group cDNA clone:J023034G08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622738.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0E0CIY50.0A0A0E0CIY5_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g17190.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP165241011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.15e-34myb domain protein 3r-4